Cyhr1

Author: gdoq

August undefined, 2024

WebInvitrogen Anti-CYHR1 Polyclonal, Catalog # PA5-66263. Tested in Western Blot (WB) and Immunocytochemistry (ICC/IF) applications. This antibody reacts with Human samples. Supplied as 100 µL purified antibody (0.05 mg/mL). Webanti-CYHR1 antibody (Cysteine/histidine-Rich 1) AA 51-100. anti-CYHR1 antibody (Cysteine/histidine-Rich 1) Middle Region. Browse Primary Antibodies and Browse …

As a Novel Prognostic Marker, Cysteine/histidine-rich 1 …

WebCYHR1 (HGNC Symbol) Synonyms: CHRP, KIAA0496, MGC13010: Description: Cysteine and histidine rich 1 (HGNC Symbol) Entrez gene summary: Chromosome: 8: Cytoband: … WebHigh CYHR1 expression is associated with Esophageal Squamous Cell Carcinoma. ... bubbles with glycerin recipe

P0DTL6 - UniProt

WebProtein Description: cysteine/histidine-rich 1 Gene Name: CYHR1 Alternative Gene Name: CHRP, KIAA0496, MGC13010 Sequence: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ Interspecies mouse/rat: ENSMUSG00000053929: 91%, ENSRNOG00000014811: 91% … WebCyhr1 cysteine and histidine rich 1 [ (house mouse)] Gene ID: 54151, updated on 8-Nov-2024 Summary Predicted to enable zinc ion binding activity. Located in cytoplasm and … WebCYHR1 in human cancer is unknown.16–19 To evaluate the role and signiﬁcance of CYHR1 in ESCC, we established CYHR1 knock-out esophageal cancer cells by using the small interfering RNA (siRNA) transfection method. Then, we performed a functional analysis, used reverse tran-scription-polymerase chain reaction (RT-PCR) to detect the bubblicious orange gum

Oncostatin M receptor β and cysteine/histidine-rich 1 are …

Pre-made anti-CYHR1 monoclonal antibody(mab)-benchmark …

WebMeaning. CVHR. Cyclic Variation of Heart Rate (cardiology) CVHR. Citizens' Voice for Health Rights (Canada) CVHR. Cardiovasculaire, Hémostase, Respiration (French: … WebJul 1, 2004 · Background: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship between the CYHR1 gene ... bubbling candleWebPharos : Target Details - CYHR1 Jump to section: close Descriptive Data Protein Summary Protein Classes IDG Development Level Summary Expression Data Protein Sequence … bubbly brunch dinner at tiffani

"WebBackground: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship … " - Cyhr1

Cyhr1

WebID: CYHR1_HUMAN DESCRIPTION: RecName: Full=Cysteine and histidine-rich protein 1; SUBUNIT: Interacts with LGALS3 (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). Cytoplasm, perinuclear region (By similarity). Note=Shows a prominent perinuclear and cytoplasmic localization (By similarity). SIMILARITY: Belongs to the … WebThe estimate of $40 million for the total cost of this program is based on an assumed 100 researchers leading 400 short courses for 6,000 other individuals.(12) These funds …

Did you know?

WebThe deduced 311-amino acid protein has an N-terminal cysteine- and histidine-rich domain that shares similarity with metal-binding zinc finger domains in other proteins. Northern … WebMar 1, 2011 · This CYHR1 fragment is almost as good a predictor of good response (receiver operating characteristic=0.91) as OSMR is a predictor of poor response (receiver operating characteristic=0.98). The current state of knowledge on CYHR1 is limited regarding its predicted protein structure, protein–protein interactions, subcellular …

WebMar 21, 2024 · lnc-CYHR1-1 is an RNA Gene, and is affiliated with the lncRNA class. Additional gene information for lnc-CYHR1-1 Gene Search for lnc-CYHR1-1 at DataMed Search for lnc-CYHR1-1 at HumanCyc WebMar 21, 2024 · GeneHancers around lnc-CYHR1-1 on the GeneHancer Hub at the UCSC Golden Path Genomic Locations for lnc-CYHR1-1 Gene Latest Assembly …

WebCYHR1 is part of cluster 35 Non-specific - Unknown function with confidence i Confidence is the fraction of times a gene was assigned to the cluster in repeated clustering, and … WebCYHR1 Alias symbols CHRP, KIAA0496, MGC13010 %HI 61.63(Read more about the DECIPHER Haploinsufficiency Index) pLI 0.49(Read more about gnomAD pLI score) LOEUF 0.53(Read more about gnomAD LOEUF score) Cytoband 8q24.3 Genomic Coordinates. GRCh37/hg19: chr8:145674965-145691084: NCBI Ensembl UCSC:

Web616635 - cysteine- and histidine-rich protein 1; cyhr1 - chrp;; kiaa0496 - zftraf1

WebThis target displays homology in the following species: Cow: 93%; Human: 100%; Mouse: 100%; Rat: 100% Target Information CYHR1 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include nucleoplasm; zinc ion binding. For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization. bubbling well pointWebDec 17, 2015 · Background: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship between the CYHR1... bubbly manufacturerWebPrEST Antigen CYHR1; Blocking agent and positive assay control using corresponding antibodies. Bulk and Prepack available at Sigmaaldrich.com. US EN. Applications Products Services Support. APREST89884; All Photos (1) APREST89884. PrEST Antigen CYHR1. bubblywot bubbly festivalWebCYHR1 Gene - Somatic Mutations in Cancer Actionability v8 is now available for download Gene GRCh38 · COSMIC v97 Gene view The gene view histogram is a graphical view of … bubbynuts2787WebCysteine/histidine-rich 1 (CYHR1) was ﬁrst discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a rela- tionship between the … bubbue-tl6WebCYHR1 Antibody. Applications: ICC/IF, WB, IHC. Reactivity: Human, Mouse. Images: 5. Clonality: Polyclonal. Conjugates: Unconjugated. bubbly urine in the morning